PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G32710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 870aa    MW: 90418.8 Da    PI: 6.7288
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G32710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-096616981954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OGLUM03G32710.1 661 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 698
                      564459******************************88 PP

2BELL91.11.1e-295375921772
             BELL  17 eeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      + Vd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  OGLUM03G32710.1 537 DDVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 592
                      68***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.4E-54410590IPR006563POX domain
PfamPF075265.2E-50415589IPR006563POX domain
PROSITE profilePS5007112.6639702IPR001356Homeobox domain
CDDcd000865.29E-13642703No hitNo description
SMARTSM003891.6E-9642706IPR001356Homeobox domain
SuperFamilySSF466893.08E-17644709IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28645708IPR009057Homeodomain-like
PfamPF059204.5E-18659698IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 870 aa     Download sequence    Send to blast
MERRRSRRQQ AFHPVAAEEE EEEGLVVVGR RSTADDGDSG AAGMGIAAPP CQPGQTTTFV  60
ISQPTSSKSS PAAIVVRPPA TASSSSMSHS QGFHQPSSGA VFGFSSDGFD GRPGSGQDHQ  120
QHEQQQQQHV AQQSRRDKLR VQGFDPAAAA AGHGLLPIEG DEHGADPGAM YDHAEAAAAG  180
ASNMLSEMFN FPSQPPTGPS ATELLASQMN ANYRFGFRQA AGLAGGEGGW FGGGGAAGRT  240
GLVLGGASLG SLGETSSPKQ QAGGMAGLAA DPAAAMHLFL MNPQQQQQQS RSSTSPPPSD  300
AQSAIHQHHE AFQAFGGAGA AAFGGGAAAG VVEGQGLSLS LSPSLQQLEM AKQAEELRVR  360
DGVLYFNRQQ QQQQAAAAAA SVQQQLPMAL HGQVGVLGQQ LHGGGYGGPA GIAGVLRNSK  420
YTRAAQELLE EFCSVGRGQI KGGGGRGSAP NNPNSSKAAA GAASSSGAAQ SPSSASKEPP  480
QLSPAERFEH QRKKAKLISM LDEARIHLSS PLACMAPSIY SPPPTHRRHA SADVDDDDVD  540
RRYNHYCDQM QMVVNFFDSV MGFGAATPYT ALAQKAMSRH FRCLKDAIAA QLRGTCEALG  600
EKDAGTGSGL TKGETPRLRA IDQSLRQQRA FHHMGIMEQE AWRPQRGLPE RSVNILRSWL  660
FEHFLHPYPS DADKHLLARQ TGLSRNQVSN WFINARVRLW KPMIEEMYQQ ECKELEGSSG  720
AGDDPSGADD THSPTTTAAA HHQHRHGQLM VEHGGASSGG GAALSSHKHE PGVVAGPSSS  780
SAAAVADAAF VGIDPVELLG GDGAAADDLY GRFDPAGAVR VRYGPAGAAA GGAAAAAGDV  840
SLTLGLQHAG AGNAGPDGSG RFSLRDYSGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-17648705158Homeobox protein Meis1
4xrs_B1e-17648705158Homeobox protein Meis1
5bng_A1e-17648706159Homeobox protein Meis2
5bng_B1e-17648706159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1035500.0AC103550.13 Oryza sativa chromosome 3 BAC OSJNBa0079G12 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631398.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-130BLH4_ARATH; BEL1-like homeodomain protein 4
SwissprotQ9SW801e-129BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A0D9ZCP60.0A0A0D9ZCP6_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g52239.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-113BEL1-like homeodomain 4